• Home

cementerio de hyperlinks

Blogger templates

Categories

  • ? (1)
  • " (1)
  • 07 (1)
  • 1 dollar? what? (1)
  • 1990s (1)
  • 1st night (1)
  • 200th post (1)
  • 2010 (2)
  • 2011 el año de la trompeta (1)
  • 23 (1)
  • 2500 (1)
  • 2k9 (1)
  • 2nd night (1)
  • 3:20 (1)
  • 4.10.10 (1)
  • 97 (1)
  • a new dawn (1)
  • acetato de sodio (1)
  • adbusters (1)
  • afrobeats (2)
  • albums to sing along drunk (1)
  • albums you must hear (1)
  • algunos thoughts (2)
  • all for the best (1)
  • always different (1)
  • always the same (1)
  • amazing ending (1)
  • ambulante 2010 (1)
  • ana karenina (1)
  • antmusic (1)
  • art (1)
  • ay (1)
  • ayer antes de llover (1)
  • babble (2)
  • baby smokes (1)
  • baby youre my ride (1)
  • back to life (1)
  • battlestar galactica (1)
  • baudrillard (1)
  • best of the best (27)
  • best original scores (1)
  • big love (1)
  • biggie smalls (1)
  • bitch deserved it (1)
  • blogs worth blogging about (4)
  • bob dylan (2)
  • boh (3)
  • bon iver (1)
  • bonnaroo 09: road to ruin (5)
  • bought (1)
  • bowerbirds (4)
  • brasil 66 (1)
  • brittany murphy (1)
  • bsg (1)
  • bssssssssssssss (1)
  • buscando (1)
  • but not me (1)
  • but not tonight (1)
  • capitalism isnt working (1)
  • charlie kaufman (1)
  • chatroulette (1)
  • cheers (1)
  • chicken (1)
  • chillwave (1)
  • chocolate lips (1)
  • chuck bass (1)
  • clase de 2000 (1)
  • clase de cine (3)
  • class tunes (1)
  • coachella 2010 (1)
  • coachella talk (5)
  • cody (1)
  • cold night (1)
  • como los viejos tiempos (1)
  • concurso Ciencia ficción uabc (1)
  • contests (3)
  • correcaminos (1)
  • cosas asquerosas (1)
  • cosas suaves (1)
  • creepy (1)
  • cute (1)
  • cuteness (1)
  • david bowie (1)
  • david byrne (1)
  • david hume (1)
  • david lynch-esque (1)
  • daytrotter (1)
  • deje de ser tu hijo ahora eres mi padre (1)
  • deleuze (1)
  • delta (3)
  • depeche vs new order = new order hell yeah (1)
  • devendra (2)
  • dignity (1)
  • dirty projectors (2)
  • dirty ps (1)
  • dj sets (1)
  • do i buy a wig (1)
  • docs (1)
  • donde esta la playa (3)
  • dondestalaplaya (2)
  • dont look back (1)
  • doom patrol (1)
  • dormir (1)
  • dr cuerdas (1)
  • dreampop (1)
  • drizzy (1)
  • drugs (1)
  • eggs (1)
  • el dinero no habla (1)
  • el mas interesante (1)
  • El Queso Y Los Gusanos (1)
  • el scott se la volo (1)
  • elliott smith (1)
  • ellis (1)
  • emily wells (1)
  • emotional post (1)
  • ensayo (9)
  • ensenada (1)
  • escucha a nick cave (1)
  • espanol (2)
  • esta radiohead y esta todo lo demas (1)
  • estomago vacio (1)
  • euro10 (1)
  • facultad de humanidades (1)
  • fast like you (1)
  • feb 2009 (1)
  • fela kuti (2)
  • films (2)
  • films for hipsters (2)
  • For hundreds of years we have believed that increased material wealth makes us happier and we have shaped our world accordingly (1)
  • fox confessor (1)
  • frances bacon (1)
  • free chris brown (1)
  • FRESH (1)
  • ftw (1)
  • fuck media detox (1)
  • fuckcartney (1)
  • fuckin gold (1)
  • full lips (1)
  • funny (1)
  • gaspar noe (1)
  • Girls used to diss me now they write letter 'cause they miss me (1)
  • giro (1)
  • giveaways (3)
  • giving in (1)
  • glorious lists (2)
  • gondry (2)
  • gracias (1)
  • grant morrison (1)
  • great films (1)
  • grouper (1)
  • halconazo (1)
  • hambre (1)
  • hdcp (1)
  • hellvista (1)
  • hipinion (1)
  • hipinion 80s comp (1)
  • holes through stomachs (1)
  • homo (1)
  • hope sandoval super hot (1)
  • hot night (1)
  • hoy (2)
  • husserl (1)
  • hypem (1)
  • hypervirus (1)
  • i dont float (1)
  • I forgot to remember to forget her (1)
  • i just want lost to start already so i can go to bed (1)
  • i know what's waiting for me (1)
  • i miss you a lot (1)
  • i wanna kill myself (via posting) (1)
  • ian brown (1)
  • identidad (1)
  • im strange enough to change yo (1)
  • in the name of trugh (1)
  • injerto (1)
  • insulta (1)
  • irony (1)
  • is the rattling of a stick inside a swill bucket (1)
  • it's all in the game (1)
  • its all over now baby blue (1)
  • its alright everybody chill (1)
  • its not tv its hbo (1)
  • its so late (1)
  • ja mie (1)
  • jeff buckley (1)
  • jeff mangum (1)
  • jelly (1)
  • jeremy jay (1)
  • jessie evans mezca (1)
  • john berger (1)
  • johnny marr (1)
  • jonny is so dreamy (1)
  • joy (1)
  • joya (1)
  • julia (1)
  • kcrw (1)
  • killer albums (1)
  • killer links (2)
  • killer tunes (4)
  • killer vids (1)
  • king (1)
  • kitsch (1)
  • la llama que llama (1)
  • la placa (1)
  • la scarjo esta enamorada (1)
  • la uva (1)
  • lacan (1)
  • land of the free but not me not me (1)
  • last post of the bugle (1)
  • late night (1)
  • latitude (2)
  • le corbusier (4)
  • le serie (1)
  • legends (1)
  • let me know (1)
  • life is expensive (1)
  • life on mars (1)
  • lists (3)
  • live (1)
  • llego tat (1)
  • llorón (1)
  • lol (2)
  • lolwut (1)
  • loney dear (1)
  • long long time since you lost your way (1)
  • lost (10)
  • lost in your knockers (1)
  • lost thoughts (1)
  • lou reed (1)
  • love (1)
  • love like a sunset (1)
  • major hotness (1)
  • major lazer (1)
  • malcolm middleton (1)
  • mangum (1)
  • marinetti (1)
  • marshall mcluhan (1)
  • marzo 2010 (1)
  • mazzy star (2)
  • McCloud (1)
  • mcluhan (2)
  • me equivoque de blog (1)
  • meaningful festivals (5)
  • meaningful friends (1)
  • mediafire (2)
  • mick jagger (1)
  • midlake (1)
  • minsk and the madcap tribe (1)
  • mixtape (1)
  • mj (1)
  • mk (2)
  • mondays is for drinking to the seldom seen kid (1)
  • monkey vs man war has begun (1)
  • moon (1)
  • muerte iturbide (1)
  • my stepfather sucks (1)
  • navidark (1)
  • neko (1)
  • new order (2)
  • newsom (1)
  • nick cave (2)
  • nmh (2)
  • no logo (1)
  • ny phone conv (1)
  • occupy (3)
  • off to edit (1)
  • ohh (1)
  • on the current state of music (1)
  • once upon a time (1)
  • orgullo de la civilizacion (1)
  • orwell's 1984 (1)
  • otis (1)
  • our birthright (1)
  • pain (1)
  • paint the black hole blacker (1)
  • part one (1)
  • part two (2)
  • party (1)
  • pavement (1)
  • pfaller (1)
  • phoenix (2)
  • photobooth (1)
  • pinche tec esta chingon (1)
  • piracy (4)
  • pirateria (1)
  • pitchfork commy (2)
  • playlist (1)
  • pop nihilism (1)
  • post de coach (1)
  • post para el scott dylan fanatic (1)
  • pretty cool news (2)
  • Prisencolinensinainciusol (1)
  • prison girls (1)
  • radio dept. (1)
  • rants (8)
  • re (1)
  • regalame esta noche (1)
  • regalame tu vida (1)
  • Renato Cartesio (1)
  • rh (2)
  • rolas muy buenas (1)
  • romantic rights (1)
  • rosebud (1)
  • royksopp (1)
  • rudeza (1)
  • ruta one (1)
  • ruta uno (1)
  • salvaje desnudo (1)
  • sandra lyrics (1)
  • sarah suskind (1)
  • scarjo marry me (1)
  • scheme (1)
  • science fiction shit (1)
  • sea exchange (1)
  • segmento lets talk tunes (1)
  • seinfeld opening theme (1)
  • seminario de géneros limítrofes (1)
  • sept 25th 2008 (1)
  • sex (1)
  • sex with penelope cruz (1)
  • sexo en persona (1)
  • sexy (1)
  • shellshock (1)
  • shows (2)
  • sleepy (1)
  • so funny (1)
  • sobre gente que no sabe parar (1)
  • social commentary on racism (1)
  • soulseek (1)
  • space is the place (1)
  • steampunk (1)
  • stephen fry (1)
  • stone roses (1)
  • strange dreams (1)
  • suit and tie without jay z version (1)
  • summer heights high (1)
  • sunshine lollipops and rainbows (1)
  • supposed to do (1)
  • t in the park (1)
  • tablas en escape (1)
  • tables and chairs (1)
  • taking for granted vampires exist (1)
  • TEDP (1)
  • television at its best (4)
  • the 8th light is gonna shine bright tonight (1)
  • the band (1)
  • the best (1)
  • the black keys hell yeah (3)
  • the grammys can s my d (1)
  • the human centipede (1)
  • the libs (2)
  • the loft ucsd (1)
  • the sopranos (1)
  • the wire (3)
  • the wrestler (1)
  • they should give it the fuckin chair (1)
  • things that are weird (1)
  • this is fun (1)
  • this modern life breaks me (1)
  • thisiswhyyourefat (2)
  • thom yorke (1)
  • threats (1)
  • tijuana (1)
  • tiny girls (1)
  • todavía no empiezo el reportaje (1)
  • tokyo (1)
  • tokyo police club en coach estuvieron curada la neta que lastima que no hicieron nada curada despues del ep (1)
  • top list (1)
  • torrents (1)
  • tropical (1)
  • tuggable babes (1)
  • tunes of the year (2)
  • twisted karaoke (1)
  • uabc (4)
  • un espaniol se encuentra con un chino y le dice hola el chino le dice las 12 y media (1)
  • update (1)
  • v (1)
  • valiente (1)
  • veckalazywednesdaykickassspeakerstimest (1)
  • venecia (1)
  • vetiver (1)
  • walkmen (2)
  • walter benjamin (2)
  • Watch Out for Bureaucrats (1)
  • wednesday is for drinking to the seldom seen kid (1)
  • week end (1)
  • who am i kidding ill be theorizing about the island all night (1)
  • who cares (1)
  • work (1)
  • wrong (1)
  • x files (1)
  • ya no esta lloviendo (1)
  • ya son las 6 (1)
  • yeah yeah yeahs (8)
  • yoga (1)
  • young money (1)
  • zizek (1)

Archives

  • ►  2014 (2)
    • ►  December (1)
    • ►  January (1)
  • ►  2013 (6)
    • ►  May (1)
    • ►  February (3)
    • ►  January (2)
  • ►  2012 (19)
    • ►  December (1)
    • ►  October (1)
    • ►  June (1)
    • ►  March (3)
    • ►  February (3)
    • ►  January (10)
  • ►  2011 (88)
    • ►  December (2)
    • ►  November (6)
    • ►  October (5)
    • ►  September (7)
    • ►  August (13)
    • ►  July (10)
    • ►  June (6)
    • ►  May (12)
    • ►  April (3)
    • ►  March (7)
    • ►  February (8)
    • ►  January (9)
  • ►  2010 (151)
    • ►  December (6)
    • ►  November (8)
    • ►  August (4)
    • ►  June (4)
    • ►  May (17)
    • ►  April (30)
    • ►  March (24)
    • ►  February (13)
    • ►  January (45)
  • ▼  2009 (390)
    • ►  December (83)
    • ►  November (48)
    • ►  October (22)
    • ►  September (12)
    • ►  August (37)
    • ►  July (46)
    • ►  June (19)
    • ►  May (47)
    • ▼  April (19)
      • the best videos
      • farewell my
      • go influence!
      • you're the one thing
      • No title
      • me llamo ailin
      • all i wish is gone
      • no mames
      • aqui estoy
      • pinche frio
      • y yurple?
      • you said you couldnt stay
      • the question sessions
      • so awesome
      • man, good website
      • sold
      • la interpasividad
      • best sequence in the sopranos
      • quien se robo el futuro?
    • ►  March (29)
    • ►  February (26)
    • ►  January (2)
  • ►  2008 (1)
    • ►  February (1)
  • ►  2007 (1)
    • ►  September (1)
Next Post »
« Previous Post



Posted on April 25, 2009 by carlos matsuo

Post a Comment

Popular Posts

  • dark was the night
    compilation benefiting the Red Hot Organization, an international charity dedicated to raising funds and awareness for HIV and AIDS. Featuri...
  • sobre el caso megaupload
    dicen en hipinion: It bugs me that it fucked up a bunch of curated blogs, artists posting their own music, and all the other assorted rare ...
  • (no title)
    cont. en fb AAAAaaaa
  • Afghanistan legalizes rape
    Article 132 requires women to obey their husband’s sexual demands and stipulates that a man can expect to have sex with his wife at least “o...
  • Monkey Grows Tired of Beatings, Kills Owner with Coconut
    link A monkey who tired of being forced to climb trees to pick coconuts killed his owner with a well-aimed coconut. The owner died immediate...
  • lazer zeppelin - american derivative
    la música que compró el jorch el viernes. no lo pude encontrar online así que lo hice rip y lo subí para que más lo escuchen. espero que no ...
  • this is the anti-internet
    http://www.chatroulette.com/
  • vaya, eso me parecio el desmayo de un cerdo
  • Inmate Murdered After Put in Cell With Killer He Testified Against
    this is like a convicted killers dream situation http://www.foxnews.com/story/0,2933,509231,00.html
  • dont you know dont do it what you do what you should do to me
    my entry to the create a festival contest: past entries: 2006 2007

teaser de ¡basura!

http://vimeo.com/32963703

design and code by CSSReflex, supported by SloDive. Converted by Smashing Blogger for LiteThemes.com.